PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G021700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 688aa    MW: 76256.2 Da    PI: 7.2429
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G021700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.21.5e-23128228198
                          EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                          f+k+ltpsd++++g +++ +k+a+e+     +++ + +++l  +d++g  W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   
  Manes.05G021700.1.p 128 FCKILTPSDTSTHGGFSVLRKHATEClppldMNQATPTQELAAKDLHGYNWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL-- 215
                          99****************************9555556679************************************************.. PP

                          SSSEE..EEEEE- CS
                   B3  86 grsefelvvkvfr 98 
                          + +++el+v+v+r
  Manes.05G021700.1.p 216 RGDNGELRVGVRR 228
                          3489999****98 PP

2Auxin_resp104.21.6e-34254333183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRfkm+fe+eds+err++Gt++gv d++p +W++SkWrsLk
  Manes.05G021700.1.p 254 ASHAVTTQTLFVVYYKPRT--SQFIIGLNKYLEAVNHGFSVGMRFKMRFEGEDSPERRFTGTIIGVGDISP-QWSGSKWRSLK 333
                          689***************6..9***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.28E-40119257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-40121243IPR015300DNA-binding pseudobarrel domain
CDDcd100171.00E-19126228No hitNo description
PfamPF023622.2E-21128228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97128230IPR003340B3 DNA binding domain
SMARTSM010191.4E-21128230IPR003340B3 DNA binding domain
PfamPF065072.0E-32254333IPR010525Auxin response factor
PfamPF023092.0E-10575674IPR033389AUX/IAA domain
SuperFamilySSF542776.54E-12586664No hitNo description
PROSITE profilePS5174525.046588680IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MAHAESNLRD ASISCGGRGG DDLYTELWKA CAGPLVEVPR AGERVLYFPQ GHMEQLEAST  60
NQELTQQIPR FNLPSKILCR VVNIQLLAEQ ETDDVYAQIT LHPEPNQAEP TSPDSYPPEP  120
QKPTVHSFCK ILTPSDTSTH GGFSVLRKHA TECLPPLDMN QATPTQELAA KDLHGYNWRF  180
KHIFRGQPRR HLLTTGWSTF VTSKRLVAGD AFVFLRGDNG ELRVGVRRLA RQQSSMPSSV  240
ISSQSMHLGV LATASHAVTT QTLFVVYYKP RTSQFIIGLN KYLEAVNHGF SVGMRFKMRF  300
EGEDSPERRF TGTIIGVGDI SPQWSGSKWR SLKIQWDEPA TIQRPERVSP WDIEPFAAYA  360
STNLPLTVVK SKRPRPVDTP MSEITTNSTA SPFWYHGSVQ SHELSQLGSA AEAQSCESPV  420
VWPMRQKEIE SSILNGSSCN SMGRPEGIWP TSPHMNASLS LFLDSSDDNR NITTQSVISG  480
YVSPLPSWQS NGLINNQVEK GKKYENSVGC RLFGIDLTRN SNAAAPPEKE SLCSTVDPNG  540
TIGSVSAPGG SDKAQNMDNF KSSKELKQIA SDAFTRETHN KLVSTSTRSR TKVQMQGVAV  600
GRAVDLTVLK GYGDLIKELE EMFEIKGELS TRDKWAVVFT DDEGDMMLLG DDPWMEFCKM  660
VKKIIIYSSE EVKKMNTRCK FPASSHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1781636212361Auxin response factor 1
4ldw_A1e-1781636212361Auxin response factor 1
4ldv_A1e-1781636212361Auxin response factor 1
4ldx_B1e-1781636212361Auxin response factor 1
4ldx_A1e-1781636212361Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371375KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083194.10.0PREDICTED: auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A067K0910.0A0A067K091_JATCU; Auxin response factor
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9